- CCDC65 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81968
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- Rabbit
- CFAP250, FAP250, DRC2, NYD-SP28
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- CCDC65
- This antibody was developed against Recombinant Protein corresponding to amino acids: SSVLTPKEQE GIQKNNLEEL TEELTKVMVD YIGMENFWKR YNKVKLEQLS LQHRRAQLLD INGKLREMLK QYLDGISVSD EVLSQ
- PBS (pH 7.2) and 40% Glycerol
- coiled-coil domain containing 65
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- 57 kDa
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
Specifications/Features
Available conjugates: Unconjugated